Web Hosting Providers

AWS Global AcceleratorAWS Global Accelerator

AWS Global Accelerator Usage Statistics · Download List of All Websites using AWS Global Accelerator

Networking service that sends traffic through Amazon Web Service’s global network infrastructure for performance improvements.

Cloud Hosting

Profile Details

Last technology detected on 27th January 2025. We know of 3 technologies on this page and 2 technologies removed from adventhealthpharmacycentralfl.com since 25th August 2019. Link to this page.

Add BuiltWith to for free! Get lookups easily and quickly.

Get a notification when adventhealthpharmacycentralfl.com adds new technologies.

Get adventhealthpharmacycentralfl.com profile as an XML, JSON, CSV or XLSX via the Domain API.

Suggest a Technology

Can't find the technology you are looking for? Send us a suggestion, we will try and add it to our database.