French - Inferred Usage Statistics · Download List of All Websites using French - Inferred
Based on the title and description text the website content is potentially French.
GoDaddy DNS Usage Statistics · Download List of All Websites using GoDaddy DNS
DNS services provided by GoDaddy.
Amazon Usage Statistics · Download List of All Websites using Amazon
This site is hosted on Amazon AWS EC2 Infrastructure.
Cloud Hosting · Cloud PaaS
AWS Global Accelerator Usage Statistics · Download List of All Websites using AWS Global Accelerator
Networking service that sends traffic through Amazon Web Service’s global network infrastructure for performance improvements.
Cloud Hosting
Last technology detected on 10th January 2025. We know of 4 technologies on this page and 9 technologies removed from emergencydispatchingansweringservice.com since 30th December 2017. Link to this page.
Add BuiltWith to for free! Get lookups easily and quickly.
Get a notification when emergencydispatchingansweringservice.com adds new technologies.
Get emergencydispatchingansweringservice.com profile as an XML, JSON, CSV or XLSX via the Domain API.
Can't find the technology you are looking for? Send us a suggestion, we will try and add it to our database.